PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06469A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family Nin-like
Protein Properties Length: 796aa    MW: 87376.3 Da    PI: 6.7622
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06469AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK924.4e-29480531152
                     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                aek++sl++l++yF++++kdAA++Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Oropetium_20150105_06469A 480 AEKTVSLQVLRQYFAGSLKDAARSLGVCPTTLKRICRQHGINRWPSRKIKKV 531
                                5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.814470551IPR003035RWP-RK domain
PfamPF020421.9E-25483531IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2403.2E-24695777No hitNo description
SuperFamilySSF542772.55E-21696777No hitNo description
SMARTSM006663.4E-23697780IPR000270PB1 domain
PROSITE profilePS5174520.299697780IPR000270PB1 domain
PfamPF005645.5E-16698775IPR000270PB1 domain
CDDcd064077.37E-40698777No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 796 aa     Download sequence    Send to blast
MPSEGDLDLL EQLLAGDNAW FEVASRSHNS LASPPPAAFF AADAPATSSA NNGGWLLQTG  60
GASSRASPSS VRERFRQALC YIKDTQSDGD VLVQLWVPVK GHDGQLVLTT SGQPFALDQR  120
SDSLMQFREV STKYHFSADV SSGTPGLPGR VFIGRLPEWS PDVRYFTSYE YPRVSYAQTL  180
DVHGTMGLPV FEKGSYSCLG VIELIMTKQK LNFTHELNTI CSALQAVDLR STEVSSIPRI  240
KTWVTCAQQG KRGSRHSDEN YHYCISTIDE ACFVNEPQMQ KFHEACSEHH LLRGQGVAGK  300
AFKTNQPCFL PDIGSSTKLD YPLSHHAKIF NLKGAVAIRL RCTRTGIADF VLEFFLPTDC  360
EALEEQKAVL DSLSGTMRSV CQTLRVVTDR EIENEAMLEV NELNSSTPEG KNKVEELSFG  420
GSSTDRRGET WTAAAETSQQ ESQLDALRMH GMLSLDGQGP SVAGVQAAAE SGKAKKRTKA  480
EKTVSLQVLR QYFAGSLKDA ARSLGVCPTT LKRICRQHGI NRWPSRKIKK VDHSLKKLQQ  540
IIDSVHGAET AFQLNSLYKD LTNTSISSDN NLSGSITVPP TNQSNHTDTH QGHKSLSKVP  600
STSQSHSSCG DNSDSSPSCS GGATKHTPQV VLDMMNSGNL VKDIPVQPLQ TENTSLYEHF  660
SVQEPSINLL QDVTEKTNGL QHYSQSPTSP KQSADVSMRV KATFGSEKVR FKLKPECSFE  720
ELKHEIAKRL NIVDINSLVL KYLDDDSEWV LMTCDADLQE CLHVYKLADM QTIKISIYLP  780
TSPATMVING HNGFS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1473479AKKRTKA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957563.10.0PREDICTED: protein NLP1 isoform X2
RefseqXP_004957564.10.0PREDICTED: protein NLP1 isoform X2
TrEMBLK3ZQN50.0K3ZQN5_SETIT; Uncharacterized protein
STRINGSi028915m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55543852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein